SCOPe 2.05: Domain d1j6wa_: 1j6w A:

Lineage for d1j6wa_ (1j6w A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.2: Autoinducer-2 production protein LuxS [64294] (1 protein)
   contains additional N-terminal strand; possible relationships to the putative editing domain of ThrRS (d.67.1)
   automatically mapped to Pfam PF02664

6. Protein Autoinducer-2 production protein LuxS [64295] (5 species)
   S-ribosylhomocysteinase

7. Species Haemophilus influenzae [TaxId:727] [64298] (2 PDB entries)

8. Domain d1j6wa_: 1j6w A: [62663]
   complexed with met, zn

Details for d1j6wa_

PDB Entry: 1j6w, 2.1 Å

PDB Description: crystal structure of haemophilus influenzae luxs

PDB Compounds: (A:) autoinducer-2 production protein luxs

SCOPe Domain Sequences for d1j6wa_:

Sequence; same for both SEQRES and ATOM records:

>d1j6wa_ d.185.1.2 (A:) Autoinducer-2 production protein LuxS {Haemophilus influenzae [TaxId: 727]}
lldsfkvdhtkmnapavriaktmltpkgdnitvfdlrfcipnkeilspkgihtlehlfag
fmrdhlngdsieiidispmgcrtgfymsligtpneqkvseawlasmqdvlgvqdqasipe
lniyqcgsytehsledaheiaknviargigvnknedlsldn

Timeline for d1j6wa_:

• d1j6wa_ first appeared in SCOP 1.57
  
• d1j6wa_ appears in SCOPe 2.04
  
• d1j6wa_ appears in SCOPe 2.06
  
• d1j6wa_ appears in the current release, SCOPe 2.08