Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
Protein Replication factor C [64035] (1 species) contains additional alpha-helical domain after the family specific domains |
Species Pyrococcus furiosus [TaxId:2261] [64036] (1 PDB entry) |
Domain d1iqpf2: 1iqp F:2-232 [62660] Other proteins in same PDB: d1iqpa1, d1iqpb1, d1iqpc1, d1iqpd1, d1iqpe1, d1iqpf1 complexed with adp |
PDB Entry: 1iqp (more details), 2.8 Å
SCOPe Domain Sequences for d1iqpf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iqpf2 c.37.1.20 (F:2-232) Replication factor C {Pyrococcus furiosus [TaxId: 2261]} seeirevkvlekpwvekyrpqrlddivgqehivkrlkhyvktgsmphllfagppgvgktt aalalarelfgenwrhnflelnasderginvirekvkefartkpiggasfkiifldeada ltqdaqqalrrtmemfssnvrfilscnysskiiepiqsrcaifrfrplrdediakrlryi aeneglelteeglqailyiaegdmrrainilqaaaaldkkitdenvfmvas
Timeline for d1iqpf2: