Lineage for d1iqpf1 (1iqp F:233-327)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 918964Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily)
    core: 5 helices: bundle
  4. 918965Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families) (S)
    associated with N-terminal domain from the AAA+ family of P-loop hydrolases
  5. 918966Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins)
    contains an extra helix
  6. 919003Protein Replication factor C [63582] (1 species)
  7. 919004Species Pyrococcus furiosus [TaxId:2261] [63583] (1 PDB entry)
  8. 919010Domain d1iqpf1: 1iqp F:233-327 [62659]
    Other proteins in same PDB: d1iqpa2, d1iqpb2, d1iqpc2, d1iqpd2, d1iqpe2, d1iqpf2
    complexed with adp

Details for d1iqpf1

PDB Entry: 1iqp (more details), 2.8 Å

PDB Description: Crystal Structure of the Clamp Loader Small Subunit from Pyrococcus furiosus
PDB Compounds: (F:) rfcs

SCOPe Domain Sequences for d1iqpf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iqpf1 a.80.1.1 (F:233-327) Replication factor C {Pyrococcus furiosus [TaxId: 2261]}
rarpediremmllalkgnflkareklreillkqglsgedvlvqmhkevfnlpieepkkvl
ladkigeynfrlveganeiiqleallaqftligkk

SCOPe Domain Coordinates for d1iqpf1:

Click to download the PDB-style file with coordinates for d1iqpf1.
(The format of our PDB-style files is described here.)

Timeline for d1iqpf1: