Class a: All alpha proteins [46456] (284 folds) |
Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily) core: 5 helices: bundle |
Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families) associated with N-terminal domain from the AAA+ family of P-loop hydrolases |
Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins) contains an extra helix |
Protein Replication factor C [63582] (1 species) |
Species Pyrococcus furiosus [TaxId:2261] [63583] (1 PDB entry) |
Domain d1iqpf1: 1iqp F:233-327 [62659] Other proteins in same PDB: d1iqpa2, d1iqpb2, d1iqpc2, d1iqpd2, d1iqpe2, d1iqpf2 complexed with adp |
PDB Entry: 1iqp (more details), 2.8 Å
SCOPe Domain Sequences for d1iqpf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iqpf1 a.80.1.1 (F:233-327) Replication factor C {Pyrococcus furiosus [TaxId: 2261]} rarpediremmllalkgnflkareklreillkqglsgedvlvqmhkevfnlpieepkkvl ladkigeynfrlveganeiiqleallaqftligkk
Timeline for d1iqpf1: