![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
![]() | Protein Replication factor C [64035] (1 species) contains additional alpha-helical domain after the family specific domains |
![]() | Species Pyrococcus furiosus [TaxId:2261] [64036] (1 PDB entry) |
![]() | Domain d1iqpe2: 1iqp E:2-232 [62658] Other proteins in same PDB: d1iqpa1, d1iqpb1, d1iqpc1, d1iqpd1, d1iqpe1, d1iqpf1 complexed with adp |
PDB Entry: 1iqp (more details), 2.8 Å
SCOPe Domain Sequences for d1iqpe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iqpe2 c.37.1.20 (E:2-232) Replication factor C {Pyrococcus furiosus [TaxId: 2261]} seeirevkvlekpwvekyrpqrlddivgqehivkrlkhyvktgsmphllfagppgvgktt aalalarelfgenwrhnflelnasderginvirekvkefartkpiggasfkiifldeada ltqdaqqalrrtmemfssnvrfilscnysskiiepiqsrcaifrfrplrdediakrlryi aeneglelteeglqailyiaegdmrrainilqaaaaldkkitdenvfmvas
Timeline for d1iqpe2: