SCOPe 2.05: Domain d1iqpd2: 1iqp D:2-232

Lineage for d1iqpd2 (1iqp D:2-232)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein Replication factor C [64035] (1 species)
   contains additional alpha-helical domain after the family specific domains

7. Species Pyrococcus furiosus [TaxId:2261] [64036] (1 PDB entry)

8. Domain d1iqpd2: 1iqp D:2-232 [62656]
   Other proteins in same PDB: d1iqpa1, d1iqpb1, d1iqpc1, d1iqpd1, d1iqpe1, d1iqpf1
   complexed with adp

Details for d1iqpd2

PDB Entry: 1iqp, 2.8 Å

PDB Description: Crystal Structure of the Clamp Loader Small Subunit from Pyrococcus furiosus

PDB Compounds: (D:) rfcs

SCOPe Domain Sequences for d1iqpd2:

Sequence; same for both SEQRES and ATOM records:

>d1iqpd2 c.37.1.20 (D:2-232) Replication factor C {Pyrococcus furiosus [TaxId: 2261]}
seeirevkvlekpwvekyrpqrlddivgqehivkrlkhyvktgsmphllfagppgvgktt
aalalarelfgenwrhnflelnasderginvirekvkefartkpiggasfkiifldeada
ltqdaqqalrrtmemfssnvrfilscnysskiiepiqsrcaifrfrplrdediakrlryi
aeneglelteeglqailyiaegdmrrainilqaaaaldkkitdenvfmvas

Timeline for d1iqpd2:

• d1iqpd2 first appeared in SCOP 1.57
  
• d1iqpd2 appears in SCOPe 2.04
  
• d1iqpd2 appears in SCOPe 2.06
  
• d1iqpd2 appears in the current release, SCOPe 2.08