Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) division into families based on beta-sheet topologies |
Family c.37.1.20: Extended AAA-ATPase domain [81269] (26 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
Protein Replication factor C [64035] (1 species) contains additional alpha-helical domain after the family specific domains |
Species Archaeon Pyrococcus furiosus [TaxId:2261] [64036] (1 PDB entry) |
Domain d1iqpc2: 1iqp C:9-232 [62654] Other proteins in same PDB: d1iqpa1, d1iqpb1, d1iqpc1, d1iqpd1, d1iqpe1, d1iqpf1 |
PDB Entry: 1iqp (more details), 2.8 Å
SCOP Domain Sequences for d1iqpc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iqpc2 c.37.1.20 (C:9-232) Replication factor C {Archaeon Pyrococcus furiosus} kvlekpwvekyrpqrlddivgqehivkrlkhyvktgsmphllfagppgvgkttaalalar elfgenwrhnflelnasderginvirekvkefartkpiggasfkiifldeadaltqdaqq alrrtmemfssnvrfilscnysskiiepiqsrcaifrfrplrdediakrlryiaenegle lteeglqailyiaegdmrrainilqaaaaldkkitdenvfmvas
Timeline for d1iqpc2: