SCOPe 2.08: Domain d1iqpc2: 1iqp C:9-232

Lineage for d1iqpc2 (1iqp C:9-232)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (43 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein Replication factor C [64035] (1 species)
   contains additional alpha-helical domain after the family specific domains

7. Species Pyrococcus furiosus [TaxId:2261] [64036] (1 PDB entry)

8. Domain d1iqpc2: 1iqp C:9-232 [62654]
   Other proteins in same PDB: d1iqpa1, d1iqpb1, d1iqpc1, d1iqpd1, d1iqpe1, d1iqpf1
   complexed with adp

Details for d1iqpc2

PDB Entry: 1iqp, 2.8 Å

PDB Description: Crystal Structure of the Clamp Loader Small Subunit from Pyrococcus furiosus

PDB Compounds: (C:) rfcs

SCOPe Domain Sequences for d1iqpc2:

Sequence; same for both SEQRES and ATOM records:

>d1iqpc2 c.37.1.20 (C:9-232) Replication factor C {Pyrococcus furiosus [TaxId: 2261]}
kvlekpwvekyrpqrlddivgqehivkrlkhyvktgsmphllfagppgvgkttaalalar
elfgenwrhnflelnasderginvirekvkefartkpiggasfkiifldeadaltqdaqq
alrrtmemfssnvrfilscnysskiiepiqsrcaifrfrplrdediakrlryiaenegle
lteeglqailyiaegdmrrainilqaaaaldkkitdenvfmvas

Timeline for d1iqpc2:

• d1iqpc2 first appeared in SCOP 1.57
  
• d1iqpc2 appears in SCOPe 2.07