SCOP 1.57: Domain d1iqpa2: 1iqp A:2-232

Lineage for d1iqpa2 (1iqp A:2-232)

Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families)
Family c.37.1.13: Extended AAA-ATPase domain [52700] (15 proteins)
Protein Replication factor C [64035] (1 species)
Species Archaeon Pyrococcus furiosus [TaxId:2261] [64036] (1 PDB entry)
Domain d1iqpa2: 1iqp A:2-232 [62650]
Other proteins in same PDB: d1iqpa1, d1iqpb1, d1iqpc1, d1iqpd1, d1iqpe1, d1iqpf1

Details for d1iqpa2

PDB Entry: 1iqp (more details), 2.8 Å

PDB Description: Crystal Structure of the Clamp Loader Small Subunit from Pyrococcus furiosus

SCOP Domain Sequences for d1iqpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iqpa2 c.37.1.13 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus}
seeirevkvlekpwvekyrpqrlddivgqehivkrlkhyvktgsmphllfagppgvgktt
aalalarelfgenwrhnflelnasderginvirekvkefartkpiggasfkiifldeada
ltqdaqqalrrtmemfssnvrfilscnysskiiepiqsrcaifrfrplrdediakrlryi
aeneglelteeglqailyiaegdmrrainilqaaaaldkkitdenvfmvas

SCOP Domain Coordinates for d1iqpa2:

Click to download the PDB-style file with coordinates for d1iqpa2.
(The format of our PDB-style files is described here.)

Timeline for d1iqpa2: