SCOP 1.65: Domain d1iqdb2: 1iqd B:115-212

Lineage for d1iqdb2 (1iqd B:115-212)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (63 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1iqdb2: 1iqd B:115-212 [62647]
   Other proteins in same PDB: d1iqda1, d1iqda2, d1iqdb1, d1iqdc_
   part of Fab BO2C11 against the C2 domain of factor VIII
   mutant

Details for d1iqdb2

PDB Entry: 1iqd, 2 Å

PDB Description: human factor viii c2 domain complexed to human monoclonal bo2c11 fab.

SCOP Domain Sequences for d1iqdb2:

Sequence, based on SEQRES records:

>d1iqdb2 b.1.1.2 (B:115-212) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtatytcnvdhkpsntkvdkrv

Sequence, based on observed residues (ATOM records):

>d1iqdb2 b.1.1.2 (B:115-212) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplataalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvv
tvtatytcnvdhkpsntkvdkrv

Timeline for d1iqdb2:

• d1iqdb2 first appeared in SCOP 1.57
  
• d1iqdb2 appears in SCOP 1.63
  
• d1iqdb2 appears in SCOP 1.67
  
• d1iqdb2 appears in the current release, SCOPe 2.08