SCOP 1.57: Domain d1iqdb2: 1iqd B:115-212

Lineage for d1iqdb2 (1iqd B:115-212)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)

7. Species Fab BO2C11 against the C2 domain of factor VIII, (human), kappa L chain [63658] (1 PDB entry)

8. Domain d1iqdb2: 1iqd B:115-212 [62647]
   Other proteins in same PDB: d1iqda1, d1iqdb1, d1iqdc_

Details for d1iqdb2

PDB Entry: 1iqd, 2 Å

PDB Description: human factor viii c2 domain complexed to human monoclonal bo2c11 fab.

SCOP Domain Sequences for d1iqdb2:

Sequence, based on SEQRES records:

>d1iqdb2 b.1.1.2 (B:115-212) Immunoglobulin (constant domains of L and H chains) {Fab BO2C11 against the C2 domain of factor VIII, (human), kappa L chain}
astkgpsvfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtatytcnvdhkpsntkvdkrv

Sequence, based on observed residues (ATOM records):

>d1iqdb2 b.1.1.2 (B:115-212) Immunoglobulin (constant domains of L and H chains) {Fab BO2C11 against the C2 domain of factor VIII, (human), kappa L chain}
astkgpsvfplataalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvv
tvtatytcnvdhkpsntkvdkrv

Timeline for d1iqdb2:

• d1iqdb2 is new in SCOP 1.57
  
• d1iqdb2 appears in SCOP 1.59
  
• d1iqdb2 appears in the current release, SCOPe 2.08