SCOPe 2.03: Domain d1iqdb1: 1iqd B:1-114

Lineage for d1iqdb1 (1iqd B:1-114)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88544] (37 PDB entries)

8. Domain d1iqdb1: 1iqd B:1-114 [62646]
   Other proteins in same PDB: d1iqda1, d1iqda2, d1iqdb2, d1iqdc_
   part of intact IgG B12 antibody

Details for d1iqdb1

PDB Entry: 1iqd, 2 Å

PDB Description: human factor viii c2 domain complexed to human monoclonal bo2c11 fab.

PDB Compounds: (B:) human monoclonal bo2c11 fab heavy chain

SCOPe Domain Sequences for d1iqdb1:

Sequence; same for both SEQRES and ATOM records:

>d1iqdb1 b.1.1.1 (B:1-114) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
qvqlvqsgaevkkpgasvkvsckvsgytltelpvhwvrqapgkglewvgsfdpesgesiy
arefqgsvtmtadtstniaymelsslrsddtavyycavpdpdafdiwgqgtmvtvss

Timeline for d1iqdb1:

• d1iqdb1 first appeared in SCOP 1.57
  
• d1iqdb1 appears in SCOPe 2.02
  
• d1iqdb1 appears in SCOPe 2.04
  
• d1iqdb1 appears in the current release, SCOPe 2.08