Lineage for d1iqda2 (1iqd A:109-212)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1516253Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 1516254Species Human (Homo sapiens) [TaxId:9606] [88569] (144 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. 1516278Domain d1iqda2: 1iqd A:109-212 [62645]
    Other proteins in same PDB: d1iqda1, d1iqdb1, d1iqdb2, d1iqdc_
    part of Fab BO2C11 against the C2 domain of factor VIII

Details for d1iqda2

PDB Entry: 1iqd (more details), 2 Å

PDB Description: human factor viii c2 domain complexed to human monoclonal bo2c11 fab.
PDB Compounds: (A:) human monoclonal bo2c11 fab light chain

SCOPe Domain Sequences for d1iqda2:

Sequence, based on SEQRES records: (download)

>d1iqda2 b.1.1.2 (A:109-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
gtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Sequence, based on observed residues (ATOM records): (download)

>d1iqda2 b.1.1.2 (A:109-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
gtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglvtksfnr

SCOPe Domain Coordinates for d1iqda2:

Click to download the PDB-style file with coordinates for d1iqda2.
(The format of our PDB-style files is described here.)

Timeline for d1iqda2: