Lineage for d1iqda2 (1iqd A:109-212)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549707Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 549708Species Human (Homo sapiens) [TaxId:9606] [88569] (100 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 549726Domain d1iqda2: 1iqd A:109-212 [62645]
    Other proteins in same PDB: d1iqda1, d1iqdb1, d1iqdb2, d1iqdc_
    part of Fab BO2C11 against the C2 domain of factor VIII
    mutant

Details for d1iqda2

PDB Entry: 1iqd (more details), 2 Å

PDB Description: human factor viii c2 domain complexed to human monoclonal bo2c11 fab.

SCOP Domain Sequences for d1iqda2:

Sequence, based on SEQRES records: (download)

>d1iqda2 b.1.1.2 (A:109-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
gtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Sequence, based on observed residues (ATOM records): (download)

>d1iqda2 b.1.1.2 (A:109-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
gtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglvtksfnr

SCOP Domain Coordinates for d1iqda2:

Click to download the PDB-style file with coordinates for d1iqda2.
(The format of our PDB-style files is described here.)

Timeline for d1iqda2: