Lineage for d1iqda1 (1iqd A:2-108)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2353665Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2353813Species Human (Homo sapiens), cluster 3.1 [TaxId:9606] [88522] (8 PDB entries)
  8. 2353816Domain d1iqda1: 1iqd A:2-108 [62644]
    Other proteins in same PDB: d1iqda2, d1iqdb1, d1iqdb2, d1iqdc_
    part of Fab BO2C11 against the C2 domain of factor VIII

Details for d1iqda1

PDB Entry: 1iqd (more details), 2 Å

PDB Description: human factor viii c2 domain complexed to human monoclonal bo2c11 fab.
PDB Compounds: (A:) human monoclonal bo2c11 fab light chain

SCOPe Domain Sequences for d1iqda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iqda1 b.1.1.1 (A:2-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.1 [TaxId: 9606]}
ialtqspgtlslspgeratlscrasqsfsssylawyqqkpgqaprlliygastratgipd
rfsgsgsgtdftltisrlepedfavyycqkygtsaitfgqgtrleik

SCOPe Domain Coordinates for d1iqda1:

Click to download the PDB-style file with coordinates for d1iqda1.
(The format of our PDB-style files is described here.)

Timeline for d1iqda1: