SCOPe 2.04: Domain d1iqda1: 1iqd A:2-108

Lineage for d1iqda1 (1iqd A:2-108)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 3.1 [TaxId:9606] [88522] (8 PDB entries)

8. Domain d1iqda1: 1iqd A:2-108 [62644]
   Other proteins in same PDB: d1iqda2, d1iqdb1, d1iqdb2, d1iqdc_
   part of Fab BO2C11 against the C2 domain of factor VIII

Details for d1iqda1

PDB Entry: 1iqd, 2 Å

PDB Description: human factor viii c2 domain complexed to human monoclonal bo2c11 fab.

PDB Compounds: (A:) human monoclonal bo2c11 fab light chain

SCOPe Domain Sequences for d1iqda1:

Sequence; same for both SEQRES and ATOM records:

>d1iqda1 b.1.1.1 (A:2-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.1 [TaxId: 9606]}
ialtqspgtlslspgeratlscrasqsfsssylawyqqkpgqaprlliygastratgipd
rfsgsgsgtdftltisrlepedfavyycqkygtsaitfgqgtrleik

Timeline for d1iqda1:

• d1iqda1 first appeared in SCOP 1.57
  
• d1iqda1 appears in SCOPe 2.03
  
• d1iqda1 appears in SCOPe 2.05
  
• d1iqda1 appears in the current release, SCOPe 2.08