SCOP 1.63: Domain d1iq4b_: 1iq4 B:

Lineage for d1iq4b_ (1iq4 B:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.77: Ribosomal protein L5 [55281] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654

4. Superfamily d.77.1: Ribosomal protein L5 [55282] (1 family)

5. Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein)

6. Protein Ribosomal protein L5 [55284] (3 species)
   synonym: 50S ribosomal protein L5p, HMAL5, HL13

7. Species Bacillus stearothermophilus [TaxId:1422] [64317] (1 PDB entry)

8. Domain d1iq4b_: 1iq4 B: [62642]
   mutant

Details for d1iq4b_

PDB Entry: 1iq4, 1.8 Å

PDB Description: 5s-rrna binding ribosomal protein l5 from bacillus stearothermophilus

SCOP Domain Sequences for d1iq4b_:

Sequence; same for both SEQRES and ATOM records:

>d1iq4b_ d.77.1.1 (B:) Ribosomal protein L5 {Bacillus stearothermophilus}
mnrlkekylnevvpalmskfnyksimqvpkiekivinmgvgdavqnpkaldsaveeltli
agqrpvvtrakksiagfrlrqgmpigakvtlrgermyefldklisvslprardfrgvskk
sfdgrgnytlgikeqlifpeidydkvnkvrgmdivivttantdeearellallgmpfqk

Timeline for d1iq4b_:

• d1iq4b_ first appeared in SCOP 1.57
  
• d1iq4b_ appears in SCOP 1.61
  
• d1iq4b_ appears in SCOP 1.65
  
• d1iq4b_ appears in the current release, SCOPe 2.08