Lineage for d1iq4b_ (1iq4 B:)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.77: Ribosomal protein L5 [55281] (1 superfamily) Superfamily d.77.1: Ribosomal protein L5 [55282] (1 family) 
Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein) Protein Ribosomal protein L5 [55284] (2 species) Species Bacillus stearothermophilus [TaxId:1422] [64317] (1 PDB entry) 
Domain d1iq4b_: 1iq4 B: [62642]
Details for d1iq4b_
PDB Entry: 1iq4 (more details), 1.8 Å
PDB Description: 5s-rrna binding ribosomal protein l5 from bacillus stearothermophilus
SCOP Domain Sequences for d1iq4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iq4b_ d.77.1.1 (B:) Ribosomal protein L5 {Bacillus stearothermophilus}
mnrlkekylnevvpalmskfnyksimqvpkiekivinmgvgdavqnpkaldsaveeltli
agqrpvvtrakksiagfrlrqgmpigakvtlrgermyefldklisvslprardfrgvskk
sfdgrgnytlgikeqlifpeidydkvnkvrgmdivivttantdeearellallgmpfqk
SCOP Domain Coordinates for d1iq4b_:
Click to download the PDB-style file with coordinates for d1iq4b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1iq4b_:
- d1iq4b_ is new in SCOP 1.57
- d1iq4b_ appears in SCOP 1.59
- d1iq4b_ appears in the current release, SCOPe 2.08
View in 3D
