SCOPe 2.02: Domain d1iq4a_: 1iq4 A:

Lineage for d1iq4a_ (1iq4 A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.77: RL5-like [55281] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654

4. Superfamily d.77.1: RL5-like [55282] (3 families)

5. Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein)

6. Protein Ribosomal protein L5 [55284] (5 species)
   synonym: 50S ribosomal protein L5p, HMAL5, HL13

7. Species Bacillus stearothermophilus [TaxId:1422] [64317] (1 PDB entry)

8. Domain d1iq4a_: 1iq4 A: [62641]

Details for d1iq4a_

PDB Entry: 1iq4, 1.8 Å

PDB Description: 5s-rrna binding ribosomal protein l5 from bacillus stearothermophilus

PDB Compounds: (A:) 50S ribosomal protein L5

SCOPe Domain Sequences for d1iq4a_:

Sequence; same for both SEQRES and ATOM records:

>d1iq4a_ d.77.1.1 (A:) Ribosomal protein L5 {Bacillus stearothermophilus [TaxId: 1422]}
mnrlkekylnevvpalmskfnyksimqvpkiekivinmgvgdavqnpkaldsaveeltli
agqrpvvtrakksiagfrlrqgmpigakvtlrgermyefldklisvslprardfrgvskk
sfdgrgnytlgikeqlifpeidydkvnkvrgmdivivttantdeearellallgmpfqk

Timeline for d1iq4a_:

• d1iq4a_ first appeared in SCOP 1.57
  
• d1iq4a_ appears in SCOPe 2.01
  
• d1iq4a_ appears in SCOPe 2.03
  
• d1iq4a_ appears in the current release, SCOPe 2.08