Lineage for d1iq4a_ (1iq4 A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 727201Fold d.77: Ribosomal protein L5 [55281] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654
  4. 727202Superfamily d.77.1: Ribosomal protein L5 [55282] (1 family) (S)
  5. 727203Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein)
  6. 727204Protein Ribosomal protein L5 [55284] (3 species)
    synonym: 50S ribosomal protein L5p, HMAL5, HL13
  7. 727246Species Bacillus stearothermophilus [TaxId:1422] [64317] (1 PDB entry)
  8. 727247Domain d1iq4a_: 1iq4 A: [62641]

Details for d1iq4a_

PDB Entry: 1iq4 (more details), 1.8 Å

PDB Description: 5s-rrna binding ribosomal protein l5 from bacillus stearothermophilus
PDB Compounds: (A:) 50S ribosomal protein L5

SCOP Domain Sequences for d1iq4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iq4a_ d.77.1.1 (A:) Ribosomal protein L5 {Bacillus stearothermophilus [TaxId: 1422]}
mnrlkekylnevvpalmskfnyksimqvpkiekivinmgvgdavqnpkaldsaveeltli
agqrpvvtrakksiagfrlrqgmpigakvtlrgermyefldklisvslprardfrgvskk
sfdgrgnytlgikeqlifpeidydkvnkvrgmdivivttantdeearellallgmpfqk

SCOP Domain Coordinates for d1iq4a_:

Click to download the PDB-style file with coordinates for d1iq4a_.
(The format of our PDB-style files is described here.)

Timeline for d1iq4a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1iq4b_