Lineage for d1iq4a_ (1iq4 A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 81370Fold d.77: Ribosomal protein L5 [55281] (1 superfamily)
  4. 81371Superfamily d.77.1: Ribosomal protein L5 [55282] (1 family) (S)
  5. 81372Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein)
  6. 81373Protein Ribosomal protein L5 [55284] (2 species)
  7. 81374Species Bacillus stearothermophilus [TaxId:1422] [64317] (1 PDB entry)
  8. 81375Domain d1iq4a_: 1iq4 A: [62641]

Details for d1iq4a_

PDB Entry: 1iq4 (more details), 1.8 Å

PDB Description: 5s-rrna binding ribosomal protein l5 from bacillus stearothermophilus

SCOP Domain Sequences for d1iq4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iq4a_ d.77.1.1 (A:) Ribosomal protein L5 {Bacillus stearothermophilus}
mnrlkekylnevvpalmskfnyksimqvpkiekivinmgvgdavqnpkaldsaveeltli
agqrpvvtrakksiagfrlrqgmpigakvtlrgermyefldklisvslprardfrgvskk
sfdgrgnytlgikeqlifpeidydkvnkvrgmdivivttantdeearellallgmpfqk

SCOP Domain Coordinates for d1iq4a_:

Click to download the PDB-style file with coordinates for d1iq4a_.
(The format of our PDB-style files is described here.)

Timeline for d1iq4a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1iq4b_