Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.77: Ribosomal protein L5 [55281] (1 superfamily) |
Superfamily d.77.1: Ribosomal protein L5 [55282] (1 family) |
Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein) |
Protein Ribosomal protein L5 [55284] (2 species) |
Species Bacillus stearothermophilus [TaxId:1422] [64317] (1 PDB entry) |
Domain d1iq4a_: 1iq4 A: [62641] |
PDB Entry: 1iq4 (more details), 1.8 Å
SCOP Domain Sequences for d1iq4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iq4a_ d.77.1.1 (A:) Ribosomal protein L5 {Bacillus stearothermophilus} mnrlkekylnevvpalmskfnyksimqvpkiekivinmgvgdavqnpkaldsaveeltli agqrpvvtrakksiagfrlrqgmpigakvtlrgermyefldklisvslprardfrgvskk sfdgrgnytlgikeqlifpeidydkvnkvrgmdivivttantdeearellallgmpfqk
Timeline for d1iq4a_: