Lineage for d1iq3a_ (1iq3 A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47511Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 47512Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 47792Family a.39.1.6: Eps15 homology domain (EH domain) [47543] (3 proteins)
  6. 47801Protein Pob1 [63546] (1 species)
  7. 47802Species Human (Homo sapiens) [TaxId:9606] [63547] (1 PDB entry)
  8. 47803Domain d1iq3a_: 1iq3 A: [62640]

Details for d1iq3a_

PDB Entry: 1iq3 (more details)

PDB Description: solution structure of the eps15 homology domain of a human pob1

SCOP Domain Sequences for d1iq3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens)}
gslqdnssypdepwriteeqreyyvnqfrslqpdpssfisgsvaknfftksklsipelsy
iwelsdadcdgaltlpefcaafhlivarkngyplpeglpptlqpefivtd

SCOP Domain Coordinates for d1iq3a_:

Click to download the PDB-style file with coordinates for d1iq3a_.
(The format of our PDB-style files is described here.)

Timeline for d1iq3a_: