Lineage for d1ipga_ (1ipg A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1893877Superfamily d.15.2: CAD & PB1 domains [54277] (3 families) (S)
    contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily
  5. 1893893Family d.15.2.2: PB1 domain [64225] (11 proteins)
    Pfam PF00564
    forms heterodimers, although not all PB1 domain pairs associate.
  6. 1893894Protein Bud emergence mediator Bemp1 [64226] (1 species)
  7. 1893895Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64227] (2 PDB entries)
  8. 1893897Domain d1ipga_: 1ipg A: [62639]

Details for d1ipga_

PDB Entry: 1ipg (more details)

PDB Description: solution structure of the pb1 domain of bem1p
PDB Compounds: (A:) bem1 protein

SCOPe Domain Sequences for d1ipga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ipga_ d.15.2.2 (A:) Bud emergence mediator Bemp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gamgsstsglkttkikfyykddifalmlkgdttykelrskiapridtdnfklqtklfdgs
geeiktdsqvsniiqaklkisvhdi

SCOPe Domain Coordinates for d1ipga_:

Click to download the PDB-style file with coordinates for d1ipga_.
(The format of our PDB-style files is described here.)

Timeline for d1ipga_: