Lineage for d1ipga_ (1ipg A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77788Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 77890Superfamily d.15.2: CAD & PB1 domains [54277] (2 families) (S)
  5. 77906Family d.15.2.2: PB1 domain [64225] (1 protein)
  6. 77907Protein Bud emergence mediator Bemp1 [64226] (1 species)
  7. 77908Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64227] (2 PDB entries)
  8. 77910Domain d1ipga_: 1ipg A: [62639]

Details for d1ipga_

PDB Entry: 1ipg (more details)

PDB Description: solution structure of the pb1 domain of bem1p

SCOP Domain Sequences for d1ipga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ipga_ d.15.2.2 (A:) Bud emergence mediator Bemp1 {Baker's yeast (Saccharomyces cerevisiae)}
gamgsstsglkttkikfyykddifalmlkgdttykelrskiapridtdnfklqtklfdgs
geeiktdsqvsniiqaklkisvhdi

SCOP Domain Coordinates for d1ipga_:

Click to download the PDB-style file with coordinates for d1ipga_.
(The format of our PDB-style files is described here.)

Timeline for d1ipga_: