Lineage for d1iota_ (1iot A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1632226Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1632227Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1632263Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 1632323Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 1632331Species Chicken (Gallus gallus) [TaxId:9031] [53962] (531 PDB entries)
    Uniprot P00698
  8. 1632529Domain d1iota_: 1iot A: [62637]
    mutant

Details for d1iota_

PDB Entry: 1iot (more details), 1.75 Å

PDB Description: stabilization of hen egg white lysozyme by a cavity-filling mutation
PDB Compounds: (A:) Lysozyme C

SCOPe Domain Sequences for d1iota_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iota_ d.2.1.2 (A:) Lysozyme {Chicken (Gallus gallus) [TaxId: 9031]}
kvfgrcelaaalkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins
rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv
qawirgcrl

SCOPe Domain Coordinates for d1iota_:

Click to download the PDB-style file with coordinates for d1iota_.
(The format of our PDB-style files is described here.)

Timeline for d1iota_: