Lineage for d1ioid_ (1ioi D:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies) 
Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (1 family) 
Family c.56.4.1: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53183] (1 protein) Protein Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53184] (4 species) 
Species Archaeon Pyrococcus furiosus [TaxId:2261] [64099] (2 PDB entries) 
Domain d1ioid_: 1ioi D: [62632]
Details for d1ioid_
PDB Entry: 1ioi (more details), 2.7 Å
PDB Description: x-ray crystalline structures of pyrrolidone carboxyl peptidase from a hyperthermophile, pyrococcus furiosus, and its cys-free mutant
SCOP Domain Sequences for d1ioid_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ioid_ c.56.4.1 (D:) Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) {Archaeon Pyrococcus furiosus}
mkvlvtgfepfggekinpteriakdldgikigdaqvfgrvlpvvfgkakevlektleeik
pdiaihvglapgrsaisieriavnaidaripdnegkkiedepivpgaptayfstlpikki
mkklhergipayisnsaglylsnyvmylslhhsatkgypkmsgfihvpyipeqiidkigk
gqvppsmsyemeleavkvaievaleell
SCOP Domain Coordinates for d1ioid_:
Click to download the PDB-style file with coordinates for d1ioid_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ioid_:
- d1ioid_ first appeared in SCOP 1.57
- d1ioid_ appears in SCOP 1.59
- d1ioid_ appears in SCOP 1.63
- d1ioid_ appears in the current release, SCOPe 2.08
View in 3D
