Lineage for d1ioic_ (1ioi C:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 72307Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
  4. 72379Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (1 family) (S)
  5. 72380Family c.56.4.1: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53183] (1 protein)
  6. 72381Protein Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53184] (3 species)
  7. 72382Species Archaeon Pyrococcus furiosus [TaxId:2261] [64099] (2 PDB entries)
  8. 72389Domain d1ioic_: 1ioi C: [62631]

Details for d1ioic_

PDB Entry: 1ioi (more details), 2.7 Å

PDB Description: x-ray crystalline structures of pyrrolidone carboxyl peptidase from a hyperthermophile, pyrococcus furiosus, and its cys-free mutant

SCOP Domain Sequences for d1ioic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ioic_ c.56.4.1 (C:) Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) {Archaeon Pyrococcus furiosus}
mkvlvtgfepfggekinpteriakdldgikigdaqvfgrvlpvvfgkakevlektleeik
pdiaihvglapgrsaisieriavnaidaripdnegkkiedepivpgaptayfstlpikki
mkklhergipayisnsaglylsnyvmylslhhsatkgypkmsgfihvpyipeqiidkigk
gqvppsmsyemeleavkvaievaleell

SCOP Domain Coordinates for d1ioic_:

Click to download the PDB-style file with coordinates for d1ioic_.
(The format of our PDB-style files is described here.)

Timeline for d1ioic_: