Lineage for d1iofc_ (1iof C:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 182572Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
  4. 182694Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (1 family) (S)
  5. 182695Family c.56.4.1: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53183] (1 protein)
  6. 182696Protein Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53184] (4 species)
  7. 182697Species Archaeon Pyrococcus furiosus [TaxId:2261] [64099] (2 PDB entries)
  8. 182700Domain d1iofc_: 1iof C: [62627]

Details for d1iofc_

PDB Entry: 1iof (more details), 2.2 Å

PDB Description: x-ray crystalline structures of pyrrolidone carboxyl peptidase from a hyperthermophile, pyrococcus furiosus, and its cys-free mutant

SCOP Domain Sequences for d1iofc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iofc_ c.56.4.1 (C:) Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) {Archaeon Pyrococcus furiosus}
mkvlvtgfepfggekinpteriakdldgikigdaqvfgrvlpvvfgkakevlektleeik
pdiaihvglapgrsaisieriavnaidaripdnegkkiedepivpgaptayfstlpikki
mkklhergipayisnsaglylcnyvmylslhhsatkgypkmsgfihvpyipeqiidkigk
gqvppsmcyemeleavkvaievaleell

SCOP Domain Coordinates for d1iofc_:

Click to download the PDB-style file with coordinates for d1iofc_.
(The format of our PDB-style files is described here.)

Timeline for d1iofc_: