Lineage for d1iofc_ (1iof C:)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies) 
Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (1 family) 
Family c.56.4.1: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53183] (1 protein) Protein Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53184] (3 species) 
Species Archaeon Pyrococcus furiosus [TaxId:2261] [64099] (2 PDB entries) 
Domain d1iofc_: 1iof C: [62627]
Details for d1iofc_
PDB Entry: 1iof (more details), 2.2 Å
PDB Description: x-ray crystalline structures of pyrrolidone carboxyl peptidase from a hyperthermophile, pyrococcus furiosus, and its cys-free mutant
SCOP Domain Sequences for d1iofc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iofc_ c.56.4.1 (C:) Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) {Archaeon Pyrococcus furiosus}
mkvlvtgfepfggekinpteriakdldgikigdaqvfgrvlpvvfgkakevlektleeik
pdiaihvglapgrsaisieriavnaidaripdnegkkiedepivpgaptayfstlpikki
mkklhergipayisnsaglylcnyvmylslhhsatkgypkmsgfihvpyipeqiidkigk
gqvppsmcyemeleavkvaievaleell
SCOP Domain Coordinates for d1iofc_:
Click to download the PDB-style file with coordinates for d1iofc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1iofc_:
- d1iofc_ is new in SCOP 1.57
- d1iofc_ appears in SCOP 1.59
- d1iofc_ appears in the current release, SCOPe 2.08
View in 3D
