Lineage for d1iodb_ (1iod B:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 198738Fold d.169: C-type lectin-like [56435] (1 superfamily)
  4. 198739Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 198740Family d.169.1.1: C-type lectin domain [56437] (18 proteins)
  6. 198928Protein Snake coagglutinin [56446] (5 species)
  7. 198951Species Sharp-nosed viper (Deinagkistrodon acutus) [TaxId:36307] [64456] (1 PDB entry)
  8. 198953Domain d1iodb_: 1iod B: [62623]
    Other proteins in same PDB: d1iodg_

Details for d1iodb_

PDB Entry: 1iod (more details), 2.3 Å

PDB Description: crystal structure of the complex between the coagulation factor x binding protein from snake venom and the gla domain of factor x

SCOP Domain Sequences for d1iodb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iodb_ d.169.1.1 (B:) Snake coagglutinin {Sharp-nosed viper (Deinagkistrodon acutus)}
dcpsdwssyeghcykpfnepknwadaenfctqqhtgshlvsfqsteeadfvvklafqtfd
ygifwmglskiwnqcnwqwsnaamlkytdwaeesycvyfkstnnkwrsitcrmianfvce
fqa

SCOP Domain Coordinates for d1iodb_:

Click to download the PDB-style file with coordinates for d1iodb_.
(The format of our PDB-style files is described here.)

Timeline for d1iodb_: