![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
![]() | Protein Snake coagglutinin alpha chain [88861] (10 species) heterodimeric coagulation factors IX/X-binding protein (IX/X-BP) |
![]() | Species Hundred-pace snake (Deinagkistrodon acutus), different isoforms [TaxId:36307] [88865] (3 PDB entries) |
![]() | Domain d1ioda_: 1iod A: [62622] Other proteins in same PDB: d1iodb_, d1iodg_ complexed with ca |
PDB Entry: 1iod (more details), 2.3 Å
SCOPe Domain Sequences for d1ioda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ioda_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Hundred-pace snake (Deinagkistrodon acutus), different isoforms [TaxId: 36307]} dcssgwssyeghcykvfkqsktwadaesfctkqvngghlvsiessgeadfvgqliaqkik sakihvwiglraqnkekqcsiewsdgssisyenwieeeskkclgvhietgfhkwenfyce qqdpfvcea
Timeline for d1ioda_: