Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (6 families) |
Family d.169.1.1: C-type lectin domain [56437] (22 proteins) |
Protein Snake coagglutinin alpha chain [88861] (9 species) heterodimeric coagulation factors IX/X-binding protein (IX/X-BP) |
Species Sharp-nosed viper (Deinagkistrodon acutus) [TaxId:36307] [88865] (1 PDB entry) |
Domain d1ioda_: 1iod A: [62622] Other proteins in same PDB: d1iodb_, d1iodg_ complexed with ca |
PDB Entry: 1iod (more details), 2.3 Å
SCOP Domain Sequences for d1ioda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ioda_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Sharp-nosed viper (Deinagkistrodon acutus)} dcssgwssyeghcykvfkqsktwadaesfctkqvngghlvsiessgeadfvgqliaqkik sakihvwiglraqnkekqcsiewsdgssisyenwieeeskkclgvhietgfhkwenfyce qqdpfvcea
Timeline for d1ioda_: