Lineage for d1io8a_ (1io8 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2004934Protein Cyp119 [48278] (3 species)
    thermophilic P450
  7. 2004941Species Sulfolobus solfataricus [TaxId:2287] [48279] (6 PDB entries)
  8. 2004946Domain d1io8a_: 1io8 A: [62618]
    complexed with hem

Details for d1io8a_

PDB Entry: 1io8 (more details), 2 Å

PDB Description: Thermophilic cytochrome P450 (CYP119) from sulfolobus solfataricus: High resolution structural origin of its thermostability and functional properties
PDB Compounds: (A:) cytochrome p450 cyp119

SCOPe Domain Sequences for d1io8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1io8a_ a.104.1.1 (A:) Cyp119 {Sulfolobus solfataricus [TaxId: 2287]}
mydwfsemrkkdpvyydgniwqvlsyrytkevlnnfskfssdltgyherledlrngkirf
diptrytmltsdpplhdelrsmsadifspqklqtletfirettrslldsidpreddivkk
lavplpiiviskilglpiedkekfkewsdlvafrlgkpgeifelgkkyleligyvkdhln
sgtevvsrvvnsnlsdieklgyiillliagnetttnlisnsvidftrfnlwqrireenly
lkaieealrysppvmrtvrktkervklgdqtieegeyvrvwiasanrdeevfhdgekfip
drnpnphlsfgsgihlclgaplarleariaieefskrfrhieildtekvpnevlngykrl
vvrlks

SCOPe Domain Coordinates for d1io8a_:

Click to download the PDB-style file with coordinates for d1io8a_.
(The format of our PDB-style files is described here.)

Timeline for d1io8a_: