SCOPe 2.05: Domain d1io4b_: 1io4 B:

Lineage for d1io4b_ (1io4 B:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (35 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.3: Leucine zipper domain [57959] (1 family)

5. Family h.1.3.1: Leucine zipper domain [57960] (16 proteins)

6. Protein C/ebp beta [57985] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64590] (10 PDB entries)

8. Domain d1io4b_: 1io4 B: [62615]
   Other proteins in same PDB: d1io4c_, d1io4d_
   protein/DNA complex; complexed with au

Details for d1io4b_

PDB Entry: 1io4, 3 Å

PDB Description: crystal structure of runx-1/aml1/cbfalpha runt domain-cbfbeta core domain heterodimer and c/ebpbeta bzip homodimer bound to a dna fragment from the csf-1r promoter

PDB Compounds: (B:) caat/enhancer binding protein beta

SCOPe Domain Sequences for d1io4b_:

Sequence; same for both SEQRES and ATOM records:

>d1io4b_ h.1.3.1 (B:) C/ebp beta {Human (Homo sapiens) [TaxId: 9606]}
ktvdkhsdeykirrernniavrksrdkakmrnletqhkvleltaenerlqkkveqlsrel
stlrnlfkql

Timeline for d1io4b_:

• d1io4b_ first appeared in SCOP 1.57
  
• d1io4b_ appears in SCOPe 2.04
  
• d1io4b_ appears in SCOPe 2.06
  
• d1io4b_ appears in the current release, SCOPe 2.08