Lineage for d1io4b_ (1io4 B:)

  1. Root: SCOP 1.67
  2. 431023Class h: Coiled coil proteins [57942] (6 folds)
  3. 431024Fold h.1: Parallel coiled-coil [57943] (27 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 431178Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. 431179Family h.1.3.1: Leucine zipper domain [57960] (14 proteins)
  6. 431205Protein C/ebp beta [57985] (2 species)
  7. 431206Species Human (Homo sapiens) [TaxId:9606] [64590] (8 PDB entries)
  8. 431222Domain d1io4b_: 1io4 B: [62615]
    Other proteins in same PDB: d1io4c_, d1io4d_
    complexed with au

Details for d1io4b_

PDB Entry: 1io4 (more details), 3 Å

PDB Description: crystal structure of runx-1/aml1/cbfalpha runt domain-cbfbeta core domain heterodimer and c/ebpbeta bzip homodimer bound to a dna fragment from the csf-1r promoter

SCOP Domain Sequences for d1io4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1io4b_ h.1.3.1 (B:) C/ebp beta {Human (Homo sapiens)}
ktvdkhsdeykirrernniavrksrdkakmrnletqhkvleltaenerlqkkveqlsrel
stlrnlfkql

SCOP Domain Coordinates for d1io4b_:

Click to download the PDB-style file with coordinates for d1io4b_.
(The format of our PDB-style files is described here.)

Timeline for d1io4b_: