| Class h: Coiled coil proteins [57942] (6 folds) |
| Fold h.1: Parallel coiled-coil [57943] (27 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.3: Leucine zipper domain [57959] (1 family) ![]() |
| Family h.1.3.1: Leucine zipper domain [57960] (14 proteins) |
| Protein C/ebp beta [57985] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [64590] (8 PDB entries) |
| Domain d1io4b_: 1io4 B: [62615] Other proteins in same PDB: d1io4c_, d1io4d_ complexed with au |
PDB Entry: 1io4 (more details), 3 Å
SCOP Domain Sequences for d1io4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1io4b_ h.1.3.1 (B:) C/ebp beta {Human (Homo sapiens)}
ktvdkhsdeykirrernniavrksrdkakmrnletqhkvleltaenerlqkkveqlsrel
stlrnlfkql
Timeline for d1io4b_: