Lineage for d1io4a_ (1io4 A:)

  1. Root: SCOP 1.73
  2. 752207Class h: Coiled coil proteins [57942] (7 folds)
  3. 752208Fold h.1: Parallel coiled-coil [57943] (33 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 752378Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. 752379Family h.1.3.1: Leucine zipper domain [57960] (16 proteins)
  6. 752408Protein C/ebp beta [57985] (2 species)
  7. 752409Species Human (Homo sapiens) [TaxId:9606] [64590] (8 PDB entries)
  8. 752424Domain d1io4a_: 1io4 A: [62614]
    Other proteins in same PDB: d1io4c_, d1io4d_

Details for d1io4a_

PDB Entry: 1io4 (more details), 3 Å

PDB Description: crystal structure of runx-1/aml1/cbfalpha runt domain-cbfbeta core domain heterodimer and c/ebpbeta bzip homodimer bound to a dna fragment from the csf-1r promoter
PDB Compounds: (A:) caat/enhancer binding protein beta

SCOP Domain Sequences for d1io4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1io4a_ h.1.3.1 (A:) C/ebp beta {Human (Homo sapiens) [TaxId: 9606]}
khsdeykirrernniavrksrdkakmrnletqhkvleltaenerlqkkveqlsrelstlr
nlf

SCOP Domain Coordinates for d1io4a_:

Click to download the PDB-style file with coordinates for d1io4a_.
(The format of our PDB-style files is described here.)

Timeline for d1io4a_: