Lineage for d1io2a_ (1io2 A:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) Superfamily c.55.3: Ribonuclease H-like [53098] (7 families) 
Family c.55.3.1: Ribonuclease H [53099] (3 proteins) 
Protein Class II ribonuclease H (RNase HII) [53103] (3 species) 
Species Archaeon Thermococcus kodakaraensis [TaxId:311400] [64094] (1 PDB entry) 
Domain d1io2a_: 1io2 A: [62612]
Details for d1io2a_
PDB Entry: 1io2 (more details), 2 Å
PDB Description: Crystal structure of type 2 ribonuclease h from hyperthermophilic archaeon, thermococcus kodakaraensis kod1
SCOP Domain Sequences for d1io2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1io2a_ c.55.3.1 (A:) Class II ribonuclease H (RNase HII) {Archaeon Thermococcus kodakaraensis}
mkiagideagrgpvigpmviaavvvdenslpkleelkvrdskkltpkrreklfneilgvl
ddyvilelppdvigsregtlnefevenfakalnslkvkpdviyadaadvdeerfarelge
rlnfeaevvakhkaddifpvvsaasilakvtrdraveklkeeygeigsgypsdprtrafl
enyyrehgefppivrkgwktlkkiaekvesekk
SCOP Domain Coordinates for d1io2a_:
Click to download the PDB-style file with coordinates for d1io2a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1io2a_:
- d1io2a_ first appeared in SCOP 1.57
- d1io2a_ appears in SCOP 1.61
- d1io2a_ appears in the current release, SCOPe 2.08
View in 3D