![]() | Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (7 families) ![]() |
![]() | Family c.55.3.1: Ribonuclease H [53099] (3 proteins) |
![]() | Protein Class II ribonuclease H (RNase HII) [53103] (3 species) |
![]() | Species Archaeon Thermococcus kodakaraensis [TaxId:311400] [64094] (1 PDB entry) |
![]() | Domain d1io2a_: 1io2 A: [62612] |
PDB Entry: 1io2 (more details), 2 Å
SCOP Domain Sequences for d1io2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1io2a_ c.55.3.1 (A:) Class II ribonuclease H (RNase HII) {Archaeon Thermococcus kodakaraensis} mkiagideagrgpvigpmviaavvvdenslpkleelkvrdskkltpkrreklfneilgvl ddyvilelppdvigsregtlnefevenfakalnslkvkpdviyadaadvdeerfarelge rlnfeaevvakhkaddifpvvsaasilakvtrdraveklkeeygeigsgypsdprtrafl enyyrehgefppivrkgwktlkkiaekvesekk
Timeline for d1io2a_: