Lineage for d1inza_ (1inz A:)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies) Superfamily a.118.9: ENTH/VHS domain [48464] (2 families) 
Family a.118.9.1: ENTH domain [48465] (1 protein) Protein Epsin 1 [48466] (2 species) 
Species Human (Homo sapiens) [TaxId:9606] [63620] (1 PDB entry) 
Domain d1inza_: 1inz A: [62610]
Details for d1inza_
PDB Entry: 1inz (more details)
PDB Description: solution structure of the epsin n-terminal homology (enth) domain of human epsin
SCOP Domain Sequences for d1inza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1inza_ a.118.9.1 (A:) Epsin 1 {Human (Homo sapiens)}
gssrmstsslrrqmknivhnyseaeikvreatsndpwgpssslmseiadltynvvafsei
msmiwkrlndhgknwrhvykamtlmeyliktgservsqqckenmyavqtlkdfqyvdrdg
kdqgvnvrekakqlvallrdedrlreer
SCOP Domain Coordinates for d1inza_:
Click to download the PDB-style file with coordinates for d1inza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1inza_:
- d1inza_ is new in SCOP 1.57
- d1inza_ appears in SCOP 1.59
- d1inza_ appears in the current release, SCOPe 2.08, called d1inza1
View in 3D