Lineage for d1inza1 (1inz A:1-144)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2727055Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) (S)
  5. 2727056Family a.118.9.1: ENTH domain [48465] (2 proteins)
    automatically mapped to Pfam PF01417
  6. 2727057Protein Epsin 1 [48466] (2 species)
  7. 2727058Species Human (Homo sapiens) [TaxId:9606] [63620] (1 PDB entry)
  8. 2727059Domain d1inza1: 1inz A:1-144 [62610]
    Other proteins in same PDB: d1inza2

Details for d1inza1

PDB Entry: 1inz (more details)

PDB Description: solution structure of the epsin n-terminal homology (enth) domain of human epsin
PDB Compounds: (A:) eps15-interacting protein(epsin)

SCOPe Domain Sequences for d1inza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1inza1 a.118.9.1 (A:1-144) Epsin 1 {Human (Homo sapiens) [TaxId: 9606]}
mstsslrrqmknivhnyseaeikvreatsndpwgpssslmseiadltynvvafseimsmi
wkrlndhgknwrhvykamtlmeyliktgservsqqckenmyavqtlkdfqyvdrdgkdqg
vnvrekakqlvallrdedrlreer

SCOPe Domain Coordinates for d1inza1:

Click to download the PDB-style file with coordinates for d1inza1.
(The format of our PDB-style files is described here.)

Timeline for d1inza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1inza2