Lineage for d1innb_ (1inn B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1943314Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 1943315Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 1943555Family d.185.1.2: Autoinducer-2 production protein LuxS [64294] (1 protein)
    contains additional N-terminal strand; possible relationships to the putative editing domain of ThrRS (d.67.1)
    automatically mapped to Pfam PF02664
  6. 1943556Protein Autoinducer-2 production protein LuxS [64295] (5 species)
    S-ribosylhomocysteinase
  7. 1943565Species Deinococcus radiodurans [TaxId:1299] [64297] (5 PDB entries)
  8. 1943571Domain d1innb_: 1inn B: [62609]
    complexed with met, zn

Details for d1innb_

PDB Entry: 1inn (more details), 1.8 Å

PDB Description: crystal structure of d. radiodurans luxs, p21
PDB Compounds: (B:) autoinducer-2 production protein luxs

SCOPe Domain Sequences for d1innb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1innb_ d.185.1.2 (B:) Autoinducer-2 production protein LuxS {Deinococcus radiodurans [TaxId: 1299]}
vesfdldhtkvkapyvrlagvkttpkgdqiskydlrflqpnqgaidpaaihtlehllagy
mrdhlegvvdvspmgcrtgmymavigepdeqgvmkafeaalkdtaghdqpipgvselecg
nyrdhdlaaarqhardvldqglkvqetill

SCOPe Domain Coordinates for d1innb_:

Click to download the PDB-style file with coordinates for d1innb_.
(The format of our PDB-style files is described here.)

Timeline for d1innb_: