Lineage for d1inna_ (1inn A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 139995Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
  4. 139996Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
  5. 140106Family d.185.1.2: Autoinducer-2 production protein LuxS [64294] (1 protein)
  6. 140107Protein Autoinducer-2 production protein LuxS [64295] (4 species)
  7. 140113Species Deinococcus radiodurans [TaxId:1299] [64297] (2 PDB entries)
  8. 140114Domain d1inna_: 1inn A: [62608]

Details for d1inna_

PDB Entry: 1inn (more details), 1.8 Å

PDB Description: crystal structure of d. radiodurans luxs, p21

SCOP Domain Sequences for d1inna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1inna_ d.185.1.2 (A:) Autoinducer-2 production protein LuxS {Deinococcus radiodurans}
nvesfdldhtkvkapyvrlagvkttpkgdqiskydlrflqpnqgaidpaaihtlehllag
ymrdhlegvvdvspmgcrtgmymavigepdeqgvmkafeaalkdtaghdqpipgvselec
gnyrdhdlaaarqhardvldqglkvqetill

SCOP Domain Coordinates for d1inna_:

Click to download the PDB-style file with coordinates for d1inna_.
(The format of our PDB-style files is described here.)

Timeline for d1inna_: