Lineage for d1inja_ (1inj A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 126172Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
  4. 126173Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (11 families) (S)
  5. 126331Family c.68.1.13: Cytidylytransferase [68901] (3 proteins)
  6. 126332Protein 4-diphosphocytidyl-2-c-methylerythritol (CDP-me) synthase (YgbP) [64140] (1 species)
  7. 126333Species Escherichia coli [TaxId:562] [64141] (3 PDB entries)
  8. 126335Domain d1inja_: 1inj A: [62607]

Details for d1inja_

PDB Entry: 1inj (more details), 1.55 Å

PDB Description: crystal structure of the apo form of 4-diphosphocytidyl-2-c-methylerythritol (cdp-me) synthetase (ygbp) involved in mevalonate independent isoprenoid biosynthesis

SCOP Domain Sequences for d1inja_:

Sequence, based on SEQRES records: (download)

>d1inja_ c.68.1.13 (A:) 4-diphosphocytidyl-2-c-methylerythritol (CDP-me) synthase (YgbP) {Escherichia coli}
hldvcavvpaagfgrrmqtecpkqylsignqtilehsvhallahprvkrvviaispgdsr
faqlplanhpqitvvdggderadsvlaglkaagdaqwvlvhdaarpclhqddlarllals
etsrtggilaapvrdtmkraepgknaiahtvdrnglwhaltpqffprellhdcltralne
gatitdeasaleycgfhpqlvegradnikvtrpedlalaefylt

Sequence, based on observed residues (ATOM records): (download)

>d1inja_ c.68.1.13 (A:) 4-diphosphocytidyl-2-c-methylerythritol (CDP-me) synthase (YgbP) {Escherichia coli}
hldvcavvpaakqylsignqtilehsvhallahprvkrvviaispgdsrfaqlplanhpq
itvvdggderadsvlaglkaagdaqwvlvhdaarpclhqddlarllalsetsrtggilaa
pvrdtmkraepgknaiahtvdrnglwhaltpqffprellhdcltralnegatitdeasal
eycgfhpqlvegradnikvtrpedlalaefylt

SCOP Domain Coordinates for d1inja_:

Click to download the PDB-style file with coordinates for d1inja_.
(The format of our PDB-style files is described here.)

Timeline for d1inja_: