SCOP 1.67: Domain d1in8a1: 1in8 A:255-329

Lineage for d1in8a1 (1in8 A:255-329)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (45 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.11: Helicase DNA-binding domain [46819] (2 proteins)
   follows the extended AAA-ATPase domain

6. Protein Holliday junction helicase RuvB [46820] (2 species)

7. Species Thermotoga maritima [TaxId:243274] [63474] (6 PDB entries)

8. Domain d1in8a1: 1in8 A:255-329 [62605]
   Other proteins in same PDB: d1in8a2
   complexed with adp; mutant

Details for d1in8a1

PDB Entry: 1in8, 1.9 Å

PDB Description: thermotoga maritima ruvb t158v

SCOP Domain Sequences for d1in8a1:

Sequence; same for both SEQRES and ATOM records:

>d1in8a1 a.4.5.11 (A:255-329) Holliday junction helicase RuvB {Thermotoga maritima}
egldefdrkilktiieiyrggpvglnalaaslgveadtlsevyepyllqagflartprgr
ivtekaykhlkyevp

Timeline for d1in8a1:

• d1in8a1 first appeared in SCOP 1.57
  
• d1in8a1 appears in SCOP 1.65
  
• d1in8a1 appears in SCOP 1.69
  
• d1in8a1 appears in the current release, SCOPe 2.08