Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.11: Helicase DNA-binding domain [46819] (4 proteins) follows the extended AAA-ATPase domain |
Protein Holliday junction helicase RuvB [46820] (2 species) |
Species Thermotoga maritima [TaxId:2336] [63474] (6 PDB entries) |
Domain d1in7a1: 1in7 A:255-329 [62603] Other proteins in same PDB: d1in7a2 complexed with act, adp |
PDB Entry: 1in7 (more details), 1.9 Å
SCOPe Domain Sequences for d1in7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1in7a1 a.4.5.11 (A:255-329) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} egldefdrkilktiieiyrggpvglnalaaslgveadtlsevyepyllqagflartprgr ivtekaykhlkyevp
Timeline for d1in7a1: