Lineage for d1in7a1 (1in7 A:255-329)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45282Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 45500Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (31 families) (S)
  5. 45587Family a.4.5.11: Helicase DNA-binding domain [46819] (2 proteins)
  6. 45592Protein Holliday junction helicase RuvB [46820] (2 species)
  7. 45593Species Thermotoga maritima [TaxId:243274] [63474] (6 PDB entries)
  8. 45597Domain d1in7a1: 1in7 A:255-329 [62603]
    Other proteins in same PDB: d1in7a2

Details for d1in7a1

PDB Entry: 1in7 (more details), 1.9 Å

PDB Description: thermotoga maritima ruvb r170a

SCOP Domain Sequences for d1in7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1in7a1 a.4.5.11 (A:255-329) Holliday junction helicase RuvB {Thermotoga maritima}
egldefdrkilktiieiyrggpvglnalaaslgveadtlsevyepyllqagflartprgr
ivtekaykhlkyevp

SCOP Domain Coordinates for d1in7a1:

Click to download the PDB-style file with coordinates for d1in7a1.
(The format of our PDB-style files is described here.)

Timeline for d1in7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1in7a2