SCOPe 2.05: Domain d1in6a1: 1in6 A:255-329

Lineage for d1in6a1 (1in6 A:255-329)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.11: Helicase DNA-binding domain [46819] (4 proteins)
   follows the extended AAA-ATPase domain

6. Protein Holliday junction helicase RuvB [46820] (2 species)

7. Species Thermotoga maritima [TaxId:2336] [63474] (6 PDB entries)

8. Domain d1in6a1: 1in6 A:255-329 [62601]
   Other proteins in same PDB: d1in6a2
   complexed with act, adp, co; mutant

Details for d1in6a1

PDB Entry: 1in6, 1.8 Å

PDB Description: thermotoga maritima ruvb k64r mutant

PDB Compounds: (A:) holliday junction DNA helicase ruvb

SCOPe Domain Sequences for d1in6a1:

Sequence; same for both SEQRES and ATOM records:

>d1in6a1 a.4.5.11 (A:255-329) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]}
egldefdrkilktiieiyrggpvglnalaaslgveadtlsevyepyllqagflartprgr
ivtekaykhlkyevp

Timeline for d1in6a1:

• d1in6a1 first appeared in SCOP 1.57
  
• d1in6a1 appears in SCOPe 2.04
  
• d1in6a1 appears in SCOPe 2.06
  
• d1in6a1 appears in the current release, SCOPe 2.07