Lineage for d1in5a2 (1in5 A:17-254)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242911Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 242912Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families) (S)
    division into families based on beta-sheet topologies
  5. 244141Family c.37.1.20: Extended AAA-ATPase domain [81269] (14 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 244186Protein Holliday junction helicase RuvB [52713] (2 species)
    contains "winged helix" DNA-binding domain after the family specific domains
  7. 244187Species Thermotoga maritima [TaxId:243274] [64037] (6 PDB entries)
  8. 244193Domain d1in5a2: 1in5 A:17-254 [62600]
    Other proteins in same PDB: d1in5a1
    complexed with adp; mutant

Details for d1in5a2

PDB Entry: 1in5 (more details), 2 Å

PDB Description: thermogota maritima ruvb a156s mutant

SCOP Domain Sequences for d1in5a2:

Sequence, based on SEQRES records: (download)

>d1in5a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima}
qflrpksldefigqenvkkklslaleaakmrgevldhvllagppglgkttlahiiaselq
tnihvtsgpvlvkqgdmaailtslergdvlfideihrlnkaveellysaiedfqidimig
kgpsaksiridiqpftlvgsttrsgllssplrsrfgiileldfytvkelkeiikraaslm
dveiedaaaemiakrsrgtpriairltkrvrdmltvvkadrintdivlktmevlnidd

Sequence, based on observed residues (ATOM records): (download)

>d1in5a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima}
qflrpksldefigqenvkkklslaleaakmrgevldhvllagppglgkttlahiiaselq
tnihvtsgpvlvkqgdmaailtslergdvlfideihrlnkaveellysaiedfqidimdi
qpftlvgsttrsgllssplrsrfgiileldfytvkelkeiikraaslmdveiedaaaemi
akrsrgtpriairltkrvrdmltvvkadrintdivlktmevlnidd

SCOP Domain Coordinates for d1in5a2:

Click to download the PDB-style file with coordinates for d1in5a2.
(The format of our PDB-style files is described here.)

Timeline for d1in5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1in5a1