Lineage for d1in4a2 (1in4 A:17-254)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 180169Family c.37.1.13: Extended AAA-ATPase domain [52700] (17 proteins)
  6. 180221Protein Holliday junction helicase RuvB [52713] (2 species)
  7. 180222Species Thermotoga maritima [TaxId:243274] [64037] (6 PDB entries)
  8. 180223Domain d1in4a2: 1in4 A:17-254 [62598]
    Other proteins in same PDB: d1in4a1

Details for d1in4a2

PDB Entry: 1in4 (more details), 1.6 Å

PDB Description: thermotoga maritima ruvb holliday junction branch migration motor
PDB Compounds: (A:)

SCOP Domain Sequences for d1in4a2:

Sequence, based on SEQRES records: (download)

>d1in4a2 c.37.1.13 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima}
qflrpksldefigqenvkkklslaleaakmrgevldhvllagppglgkttlahiiaselq
tnihvtsgpvlvkqgdmaailtslergdvlfideihrlnkaveellysaiedfqidimig
kgpsaksiridiqpftlvgattrsgllssplrsrfgiileldfytvkelkeiikraaslm
dveiedaaaemiakrsrgtpriairltkrvrdmltvvkadrintdivlktmevlnidd

Sequence, based on observed residues (ATOM records): (download)

>d1in4a2 c.37.1.13 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima}
qflrpksldefigqenvkkklslaleaakmrgevldhvllagppglgkttlahiiaselq
tnihvtsgpvlvkqgdmaailtslergdvlfideihrlnkaveellysaiedfqidiqpf
tlvgattrsgllssplrsrfgiileldfytvkelkeiikraaslmdveiedaaaemiakr
srgtpriairltkrvrdmltvvkadrintdivlktmevlnidd

SCOP Domain Coordinates for d1in4a2:

Click to download the PDB-style file with coordinates for d1in4a2.
(The format of our PDB-style files is described here.)

Timeline for d1in4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1in4a1