Lineage for d1imva_ (1imv A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568174Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 2568175Superfamily e.1.1: Serpins [56574] (2 families) (S)
  5. 2568176Family e.1.1.1: Serpins [56575] (17 proteins)
    automatically mapped to Pfam PF00079
  6. 2568290Protein Pigment epithelium-derived factor, PEDF [64471] (1 species)
  7. 2568291Species Human (Homo sapiens) [TaxId:9606] [64472] (1 PDB entry)
  8. 2568292Domain d1imva_: 1imv A: [62591]
    complexed with nag

Details for d1imva_

PDB Entry: 1imv (more details), 2.85 Å

PDB Description: 2.85 a crystal structure of pedf
PDB Compounds: (A:) pigment epithelium-derived factor

SCOPe Domain Sequences for d1imva_:

Sequence, based on SEQRES records: (download)

>d1imva_ e.1.1.1 (A:) Pigment epithelium-derived factor, PEDF {Human (Homo sapiens) [TaxId: 9606]}
tgalveeedpffkvpvnklaaavsnfgydlyrvrssmspttnvllsplsvatalsalslg
adertesiihralyydlisspdihgtykelldtvtapqknlksasrivfekklrikssfv
apleksygtrprvltgnprldlqeinnwvqaqmkgklarstkeipdeisilllgvahfkg
qwvtkfdsrktsledfyldeertvrvpmmsdpkavlrygldsdlsckiaqlpltgsmsii
fflplkvtqnltlieesltsefihdidrelktvqavltvpklklsyegevtkslqemklq
slfdspdfskitgkpikltqvehragfewnedgagttpspglqpahltfpldyhlnqpfi
fvlrdtdtgallfigkildprgp

Sequence, based on observed residues (ATOM records): (download)

>d1imva_ e.1.1.1 (A:) Pigment epithelium-derived factor, PEDF {Human (Homo sapiens) [TaxId: 9606]}
tgalveeedpffkvpvnklaaavsnfgydlyrvrssmspttnvllsplsvatalsalslg
adertesiihralyydlisspdihgtykelldtvtapqknlksasrivfekklrikssfv
apleksygtrprvltgnprldlqeinnwvqaqmkgklarstkeipdeisilllgvahfkg
qwvtkfdsrktsledfyldeertvrvpmmsdpkavlrygldsdlsckiaqlpltgsmsii
fflplkvtqnltlieesltsefihdidrelktvqavltvpklklsyegevtkslqemklq
slfdspdfskitgkpikltqvehragfewnedgagtthltfpldyhlnqpfifvlrdtdt
gallfigkildprgp

SCOPe Domain Coordinates for d1imva_:

Click to download the PDB-style file with coordinates for d1imva_.
(The format of our PDB-style files is described here.)

Timeline for d1imva_: