SCOPe 2.01: Domain d1im9d2: 1im9 D:102-200

Lineage for d1im9d2 (1im9 D:102-200)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Killer cell inhibitory receptor [49202] (4 species)
   possibly an intermediate structure between the I set and FnIII domains

7. Species Human (Homo sapiens), p58-cl42 kir [TaxId:9606] [49204] (2 PDB entries)

8. Domain d1im9d2: 1im9 D:102-200 [62586]
   Other proteins in same PDB: d1im9a1, d1im9a2, d1im9b_, d1im9e1, d1im9e2, d1im9f_

Details for d1im9d2

PDB Entry: 1im9, 2.8 Å

PDB Description: Crystal structure of the human natural killer cell inhibitory receptor KIR2DL1 bound to its MHC ligand HLA-Cw4

PDB Compounds: (D:) killer cell immunoglobulin-like receptor 2dl1

SCOPe Domain Sequences for d1im9d2:

Sequence; same for both SEQRES and ATOM records:

>d1im9d2 b.1.1.4 (D:102-200) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]}
iglyekpslsaqpgptvlagenvtlscssrssydmyhlsregeaherrlpagpkvngtfq
adfplgpathggtyrcfgsfhdspyewskssdpllvsvt

Timeline for d1im9d2:

• d1im9d2 first appeared in SCOP 1.57
  
• d1im9d2 appears in SCOP 1.75
  
• d1im9d2 appears in SCOPe 2.02
  
• d1im9d2 appears in the current release, SCOPe 2.08