SCOP 1.71: Domain d1im9d1: 1im9 D:6-101

Lineage for d1im9d1 (1im9 D:6-101)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.4: I set domains [49159] (34 proteins)

6. Protein Killer cell inhibitory receptor [49202] (4 species)
   possibly an intermediate structure between the I set and FnIII domains

7. Species Human (Homo sapiens), p58-cl42 kir [TaxId:9606] [49204] (2 PDB entries)

8. Domain d1im9d1: 1im9 D:6-101 [62585]
   Other proteins in same PDB: d1im9a1, d1im9a2, d1im9b_, d1im9e1, d1im9e2, d1im9f_

Details for d1im9d1

PDB Entry: 1im9, 2.8 Å

PDB Description: Crystal structure of the human natural killer cell inhibitory receptor KIR2DL1 bound to its MHC ligand HLA-Cw4

SCOP Domain Sequences for d1im9d1:

Sequence; same for both SEQRES and ATOM records:

>d1im9d1 b.1.1.4 (D:6-101) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir}
rkpsllahpgplvkseetvilqcwsdvmfehfllhregmfndtlrligehhdgvskanfs
isrmtqdlagtyrcygsvthspyqvsapsdpldivi

Timeline for d1im9d1:

• d1im9d1 first appeared in SCOP 1.57
  
• d1im9d1 appears in SCOP 1.69
  
• d1im9d1 appears in SCOP 1.73
  
• d1im9d1 appears in the current release, SCOPe 2.08